October 1, 2026👌Great Quality Gir Cow With Female Calf For Sale (9351335071) #gircow #girgay👍

Owner:-Chhotu Yadav☎️ 9511592301
Address:- NH-8 Jaipur Road, Patan, Kishangarh, Ajmer, Rajasthan 305812

✅ Features:
• Pure Breed Gir Cows
Our Gir cows are sourced from authentic farms in Gujarat and Rajasthan.
• High Milk Production
Gir cows produce 10-15 liters of high-quality, nutritious milk per day.
• Healthy and Robust
These cows are fully vaccinated and healthy, ensuring regular care and a balanced diet.
• Low Maintenance
Gir cows are durable and low-maintenance, with strong immunity.

✅ Why buy Gir cows?
• Gir cow milk is rich in A2 protein, which is beneficial for health.
• It is adapted to the Indian climate and produces for a long time.
• It has excellent fertility.

✅ Availability:
• Cows of various ages (lactating, calving, and pregnant)
• Available at reasonable and affordable prices.

✅ Why us?
• Certified cows from Rajasthan and Gujarat.
• A name for cow service and customer trust.
• Availability of purebred cows at reasonable prices.

“Join us and adopt a purebred Gir cow. Welcome to this noble cause of cow service!”

Hello to all cow lovers, I, your friend Vikas, always upload videos of Gir cows for you, so you can join us to buy good breed cows, you can subscribe to our channel, Jai Hind Jai Gaumata. 👉All India Transport Available
👉Transportation Charge -- 14 Rupees Per Kilometers Up Down +Toll Up Down

We always have Gir Cow 🙏🙏🙏🙏🙏
👉Note:-(Gir Cow Any Time Available My Farm)
 
✅Thanks For Watching Video For Cow🙏

#shreeyadavdairyfarmpatan
#gircow #gircowmilking #milkingcow
#gircowmilking #gujratwaligircow #gujratcowgir #cowdileavery #cowbronfemalecalf
#shreeyadavdairyfarmpatankishangarhajmerrajsthan #yadavdairyfarmpatan #chhotu_yadav_patan
#girgay #Patan #cow #cowfarm #cowmilking
#cowlaver #cowvideos #cowsong ##cowdance #cowcartoon #cowfunny #gircowforsellpatan #gircowforsellkishangarh #gircowfarm #gircowbreed #gircowdairyfarm #gircowforsell #gircowfarming #girgay #gircowfarmingujrat #gircowgujrat

Queries:
Gir Cow Farm in Gujarat
gir cow dairy farm
gir cow price in india
gir cow milk
gir cow milk benefits
gir cow ghee
gir cow for sale
gir cow status
gir cow gujarat
gir cow calf
gir cow milking
Gir Cow Farm
Gir Cow Farm in Gujarat
gir cow for sale
gir cow price in india
gir cow milk benefits


#GujaratKiGirSingingVideo
#गुजरतकीगीरगायकीकीमत
#GujaratKiGirgai
#गुजरातकीगीर्गीदखाये
#Gujaratakioriginalgirgai
#गुजरतकीगीरनसलकीगाय
#Gujaratgircowfarm
#GirgaiRajasthan
#Avoid Gir Cow Scam
#Girgai
#गीरगायदुध्ववसाय
#GeeranSluckyGuy